All GLP-1 medications from licensed 503A compounding pharmacies Browse Products

LL-37 Immune & Wellness research profile visual summary
Peptide checkout

Immune research

Wellness support

Best compared against other immune & wellness profiles when you are weighing mechanism, evidence, and use case.

01

Broad-spectrum antimicrobial activity (MIC

02

Neutralizes bacterial endotoxin (LPS)

03

Disrupts established bacterial biofilms

Immune & Wellness

LL-37

LL-37 is the only human cathelicidin antimicrobial peptide. It provides broad-spectrum antimicrobial activity and modulates immune responses, playing a.

10mg vial2mg/mL · 5mL

Choose quantity

Peptide checkout

Lyophilized vials can remain stable before reconstitution when stored as directed. Provider review is required before fulfillment. Subscription intent is saved for checkout and ships every 60 days when supported by the processor.

Peptide checkout
Provider review
Ships after approval

This product can be added with other eligible peptide products. Provider review is required before fulfillment. GLP-1 programs use a separate checkout path.

Quick answer

LL-37 is an educational research profile for people comparing mechanism, potential benefits, evidence strength, and related compounds in immune & wellness.

Immune signalingInflammationBarrier defense

Format

Peptide checkout

Best use

Immune signaling

Evidence

Immune research

Product facts for search and AI answers

What this LL-37 page answers

Direct answer

LL-37 is an educational research profile for people comparing mechanism, potential benefits, evidence strength, and related compounds in immune & wellness.

This is the shortest citable answer for people comparing this option.

Best fit

Immune signaling, Inflammation, Barrier defense

LL-37 should be evaluated by goal fit, safety fit, evidence strength, and provider oversight.

Evidence signal

Immune research

3 source-backed citations are connected to this page.

Access status

Available product path; legal status and clinical fit still require review

Research products and peptides require careful review of source quality, legality, and supervision.

503A Pharmacy
USP <797> Sterile
Provider-Reviewed
Lab-Tested
Cold-Chain
HIPAA

Decision board

Is LL-37 the right page to act on?

Research profile

LL-37 is an educational research profile for people comparing mechanism, potential benefits, evidence strength, and related compounds in immune & wellness.

Best fit

Immune signaling

Outcome signal

Wellness support

Evidence cue

Immune research

Decision rhythm

Start / Compare / Explore

1

Goal

Immune signaling

2

Compare

Thymosin Alpha-1

3

Review

Immune research

4

Act

Provider review

Built from the same product facts used in the comparison table, timeline, and structured data.

Best-fit signals

Choose LL-37 when these match your goal

Immune signaling
Inflammation
Barrier defense
Compounded peptide vials arranged on a warm clinical shelf

Compounded with care

Built for multi-product peptide routines without rushing the clinical review.

FormBlends lets patients compare peptide options, build a cart, and carry selected product and quantity details into a provider-reviewed checkout path. Fulfillment still depends on eligibility, payment completion, and clinical approval.

US pharmacy sourcingProvider reviewSigned checkout payloadWLMD product IDs

Frequently researched together

Build a peptide stack before checkout

+
+

Selected stack

$492

Save $55 with stack pricing

3 products · 1 unit each · 10% stack discount

Compare at a glance

How LL-37 fits against nearby options

Use this table for the fast answer: primary fit, expected outcome, evidence signal, and the next page worth opening.

LL-37 comparison table
OptionBest forOutcome signalEvidenceNext step
LL-37 Immune & Wellness research profile visual summary

LL-37

Immune & Wellness

Immune signaling, InflammationWellness supportImmune researchCurrent page
Thymosin Alpha-1 Immune & Wellness research profile visual summary

Thymosin Alpha-1

Immune & Wellness

Immune signaling, InflammationWellness supportImmune researchCompare
KPV Immune & Wellness research profile visual summary

KPV

Immune & Wellness

Immune signaling, InflammationWellness supportImmune researchCompare
Thymalin Immune & Wellness research profile visual summary

Thymalin

Immune & Wellness

Immune signaling, InflammationWellness supportImmune researchCompare

Decision timeline

What to expect as you compare LL-37

Timelines vary by goal, dose, baseline health, and consistency. These checkpoints frame the most common evaluation moments.

Start

Understand the mechanism

Use the quick facts, pathway overview, and research notes to understand why the compound is discussed.

Compare

Match intent to evidence

Compare expected use cases, evidence strength, and related options before going deeper.

Explore

Move into detailed research

Use related articles, citations, and category pages to keep researching the safest fit.

Mechanism map

How LL-37 is positioned

LL-37 is the only human cathelicidin antimicrobial peptide. It provides broad-spectrum antimicrobial activity and modulates immune responses, playing a.

Signal

Immune signaling

Outcome

Wellness support

Proof

Immune research

The core comparison is pathway, expected outcome, evidence strength, and practical fit.

A visual summary of LL-37 across immune signaling, expected outcome, evidence signal, and comparison fit.

Key benefits

Why people compare it

1

Broad-spectrum antimicrobial activity (MIC 1-4 ug/mL against major pathogens)

2

Neutralizes bacterial endotoxin (LPS) at nanomolar concentrations via lipid A binding

3

Disrupts established bacterial biofilms by 60-80% at sub-MIC concentrations

4

Chemoattractant for neutrophils, monocytes, and T-cells via FPRL1 activation

5

Promotes wound healing through keratinocyte migration and VEGF-driven angiogenesis

6

The only human cathelicidin, providing first-line innate immune defense

7

Antiviral activity against enveloped viruses including influenza and RSV

8

Regulated by vitamin D (CAMP gene), linking vitamin D status to immune defense

Deep research

About LL-37

LL-37 is the only member of the cathelicidin antimicrobial peptide family found in humans. It is a 37-amino acid peptide with a molecular weight of approximately 4,493 Da, beginning with two leucine residues (hence the name LL-37). The full sequence is [LL-37, 37 aa] LL-37 is cleaved from its precursor protein hCAP18 (human cationic antimicrobial protein, 18 kDa) by the serine protease proteinase 3 in neutrophils and by kallikreins in keratinocytes. The gene encoding hCAP18/LL-37 is CAMP (cathelicidin antimicrobial peptide), located on chromosome 3.

The antimicrobial mechanism of LL-37 relies on its amphipathic alpha-helical structure. In aqueous solution, LL-37 adopts a random coil conformation, but upon contact with bacterial membranes, it transitions to an alpha-helix that inserts into the lipid bilayer. This creates toroidal pores that disrupt membrane integrity, leading to rapid bacterial lysis. Minimum inhibitory concentrations (MIC) against common pathogens include 1-4 ug/mL for Staphylococcus aureus, 1-2 ug/mL for Escherichia coli, and 2-4 ug/mL for Pseudomonas aeruginosa. LL-37 also shows antifungal activity against Candida species and antiviral activity against enveloped viruses including influenza and respiratory syncytial virus.

Beyond direct antimicrobial killing, LL-37 functions as a potent immunomodulatory signaling molecule. It acts as a chemoattractant for neutrophils, monocytes, and T-cells through formyl peptide receptor-like 1 (FPRL1) activation. It promotes wound healing by stimulating keratinocyte migration and proliferation, induces angiogenesis via VEGF upregulation, and modulates dendritic cell differentiation. LL-37 neutralizes lipopolysaccharide (LPS/endotoxin) at nanomolar concentrations by directly binding the lipid A moiety, preventing TLR4 activation and the subsequent inflammatory cascade that can lead to septic shock.

LL-37 demonstrates significant anti-biofilm activity, disrupting established biofilms of Pseudomonas aeruginosa, Staphylococcus epidermidis, and Staphylococcus aureus by 60-80% at sub-MIC concentrations (published in PLoS ONE and Antimicrobial Agents and Chemotherapy). This is clinically relevant because biofilm-associated infections on medical devices and chronic wounds are notoriously resistant to conventional antibiotics. LL-37 both prevents biofilm formation and penetrates existing biofilm matrices.

Clinical relevance of LL-37 deficiency is well-documented. Patients with morbus Kostmann (severe congenital neutropenia) lack LL-37 expression and suffer from severe periodontal disease despite normal neutrophil counts after G-CSF treatment. Individuals with low vitamin D levels (vitamin D directly regulates CAMP gene transcription) have reduced LL-37 production and increased susceptibility to respiratory infections, urinary tract infections, and chronic wound healing impairment. This vitamin D-LL-37 axis has been proposed as a mechanism underlying the association between vitamin D deficiency and infectious disease susceptibility.

LL-37 is administered subcutaneously in research protocols, with typical doses ranging from 50-200 mcg. The peptide has a plasma half-life of approximately 30-60 minutes and is degraded by serum proteases. Local tissue concentrations at injection sites remain elevated for several hours. LL-37 is also produced endogenously in response to infection, vitamin D signaling, and tissue injury, primarily by neutrophils (stored in specific granules at 630 ug per 10^9 cells), macrophages, and epithelial cells of the skin, respiratory tract, and urinary tract.

Lyophilized LL-37 should be stored at -20C and is stable for 18+ months. Reconstituted solutions should be refrigerated at 2-8C and used within 14 days. The peptide is soluble in water at concentrations up to 5 mg/mL. LL-37 can adsorb to glass and plastic surfaces at low concentrations, so polypropylene tubes with low-binding surfaces are recommended. Solutions should be clear; turbidity indicates aggregation and loss of activity.

The safety profile of LL-37 reflects its endogenous origin. At physiological concentrations, LL-37 is well-tolerated. At high concentrations (above 25 ug/mL), LL-37 can exhibit cytotoxicity to mammalian cells through the same membrane-disrupting mechanism used against bacteria, though selectivity for bacterial membranes is approximately 10-fold. In preclinical studies, subcutaneous injection at research doses produced no systemic toxicity. Excessive LL-37 expression has been associated with inflammatory skin conditions (rosacea, psoriasis), underscoring the importance of appropriate dosing in research settings.

Illustrative vial, bacteriostatic water, and syringe flatlay
Illustrative only. Preparation, handling, and administration instructions must come from the dispensing pharmacy and reviewing provider.

PubMed evidence trail

Research sources used to frame this page

For LL-37, FormBlends checks the page topic against primary trials, systematic reviews, guidelines, and current PubMed-indexed literature where available. These citations are context, not medical advice, proof of eligibility, or a claim that every study applies to every patient.

Real-world LL-37 videos from creators

Authentic TikTok and Instagram clips where creators talk about LL-37, each paired with a clinical fact-check from the FormBlends medical team. Educational commentary; original creators retain rights to their videos.

Questions people ask

Frequently asked questions

What is LL-37 best for?

LL-37 is best for people researching immune signaling, inflammation, barrier defense within the broader immune & wellness category.

How should I compare LL-37 with alternatives?

Compare LL-37 by mechanism, evidence strength, expected timeline, side-effect profile, and whether its primary use case matches your goal.

What is the key mechanism behind LL-37?

LL-37 is the only human cathelicidin antimicrobial peptide. It provides broad-spectrum antimicrobial activity and modulates immune responses, playing a.

Where should I go next after reading this LL-37 guide?

Review the related immune & wellness profiles, scan the research notes, and compare the best-fit category page before making decisions.