All GLP-1 medications from licensed 503A compounding pharmacies Browse Products

LL-37 Peptide Buy: Review, Evidence & Sourcing Guide | FormBlends

Buy LL-37 peptide with confidence. Evidence ledger, mechanism data, purity gotchas, honest head-to-head vs alternatives, and label-literacy tips in one...

Medically Reviewed

Written by the FormBlends Medical Team, a group of biomedical scientists and clinical researchers. · Reviewed by FormBlends Medical Content Team

LL-37 Peptide Buy: Review, Evidence & Sourcing Guide | FormBlends custom 2026 header image for Peptide Therapy
Custom header image for LL-37 Peptide Buy: Review, Evidence & Sourcing Guide | FormBlends, Peptide Therapy, and better treatment decision-making.
In This Article

This article is part of our Peptide Therapy collection. See also: GLP-1 Guides | Provider Comparisons

Search and AI answer brief

Practical answer: LL-37 Peptide Buy: Review, Evidence & Sourcing Guide | FormBlends

Buy LL-37 peptide with confidence. Evidence ledger, mechanism data, purity gotchas, honest head-to-head vs alternatives, and label-literacy tips in one...

Short answer

Buy LL-37 peptide with confidence. Evidence ledger, mechanism data, purity gotchas, honest head-to-head vs alternatives, and label-literacy tips in one...

Search intent

This page answers a specific Peptide Therapy question rather than a generic overview.

What to verify

peptide evidence quality, cash price and coverage terms, safety and contraindications

How to use it

Use this information to prepare sharper questions for a licensed provider.

Abstract scientific illustration for peptides ll 37 buy review

Trust Signals

  • Written by the FormBlends Medical Team, a group of biomedical scientists and clinical researchers.
  • All evidence claims are graded by study type. Mechanism is separated from clinical proof throughout.
  • No affiliate relationship with any specific supplier is disclosed on this page. All comparison data is independent.
  • Last reviewed and updated: 2026-05-29.
  • This page is for research and educational purposes. LL-37 is not FDA-approved for human therapeutic use.

Key Takeaways

  • LL-37 is a 37-amino-acid cathelicidin peptide (residues 134 to 170 of hCAP18) and the only human cathelicidin; its CAMP gene contains a vitamin D response element that measurably regulates expression in monocytes and epithelial cells.
  • The strongest human evidence links LL-37 deficiency to infection susceptibility (morbus Darier, atopic dermatitis); controlled human intervention trials evaluating exogenous LL-37 administration are very limited as of 2026.
  • Physiological salt concentrations (roughly 150 mM NaCl) substantially reduce LL-37 antimicrobial potency in vitro, the single most important limitation most peptide vendor pages omit.
  • Endotoxin contamination below 1 EU per milligram is the correct threshold for cell-based assays; batches without LAL or rFC endotoxin test results can produce entirely artifactual cytokine data.
  • LL-37 is on the WADA prohibited list under the Peptides and Regulatory Hormones category, meaning competitive athletes face anti-doping consequences regardless of jurisdiction legality.

What Is LL-37 and Should You Buy It for Research?

If you are buying LL-37 peptide for legitimate in vitro or preclinical research, it is a well-characterized, commercially available compound with a defined sequence and meaningful mechanistic literature. Require HPLC purity above 98%, mass spec confirmation, and endotoxin test data before purchase. No human therapeutic evidence currently justifies clinical use outside a trial setting.

What Exactly Is LL-37 Peptide?

LL-37 is a cationic, amphipathic alpha-helical peptide of 37 amino acids (molecular weight approximately 4,493 Da). Its name reflects its two N-terminal leucines and its length. It is the C-terminal proteolytic fragment of hCAP18 (human cationic antimicrobial protein of 18 kDa), encoded by the CAMP gene on chromosome 3p21.3. It is the sole member of the cathelicidin family expressed in humans.

LL-37

From the FormBlends catalog

LL-37

The body's natural antimicrobial defense peptide · From $199/mo · compounded by a licensed 503A pharmacy, dispensed only after provider review.

View LL-37 →

The sequence is: [LL-37, 37 aa] Key structural features include a net charge of roughly +6 at physiological pH and a hydrophobic moment that permits membrane intercalation. In aqueous solution LL-37 is largely unstructured; it adopts its alpha-helical conformation on contact with anionic bacterial membranes or in the presence of lipopolysaccharide.

Natural sources of LL-37 in the body include neutrophil granules, skin keratinocytes (especially after injury), mucosal epithelial cells, and seminal plasma. Expression is upregulated by infection, wounding, and vitamin D receptor activation.

How Does LL-37 Work at the Molecular Level?

LL-37 operates through at least three distinct mechanisms that are important to distinguish because their evidence bases differ substantially.

Membrane Disruption (Antimicrobial Mechanism)

The best-characterized action is electrostatic attraction to anionic bacterial membranes (bacterial outer leaflets are enriched in phosphatidylglycerol and cardiolipin, in contrast to the zwitterionic outer leaflet of mammalian cells). Once bound, the peptide inserts its hydrophobic face into the bilayer. At concentrations above a critical threshold, it forms toroidal pores or induces carpet-model lysis. Published minimum inhibitory concentration values for LL-37 against Staphylococcus aureus, Escherichia coli, and Pseudomonas aeruginosa in low-salt buffers fall approximately in the 1 to 16 micromolar range across multiple in vitro studies. The caveat: in physiological saline (150 mM NaCl) or serum, antimicrobial activity drops markedly because salt shields the electrostatic interaction and serum proteins sequester the peptide.

LPS and Nucleic Acid Binding (Immunomodulatory Mechanism)

LL-37 binds lipopolysaccharide with high affinity, neutralizing its ability to activate TLR4 and suppressing downstream NF-kB signaling. Separately, LL-37 can form complexes with self-DNA or RNA released during cell death; these complexes are taken up by plasmacytoid dendritic cells via endocytosis and stimulate TLR7 and TLR9, driving type I interferon responses. This dual capacity to both suppress and amplify innate immune signaling is context-dependent and concentration-dependent, which is why in vitro immunology results with LL-37 vary substantially across labs and cell models.

Receptor-Mediated Signaling

LL-37 activates formyl peptide receptor-like 1 (FPRL1, now designated FPR2) on neutrophils, monocytes, and mast cells at nanomolar to low micromolar concentrations. It also transactivates EGFR on epithelial cells, a pathway implicated in wound healing responses. Upregulation of VEGF expression in several cell lines has been observed, raising a noted concern in oncology research: several groups have found that LL-37 promotes tumor cell migration and angiogenesis in breast and ovarian cancer models, a pro-tumorigenic effect that commodity peptide pages reliably omit.

What Does the Evidence Actually Show? (Graded Ledger)

Claim Best Evidence Type Effect Direction Confidence
LL-37 deficiency in morbus Darier patients increases bacterial skin infection susceptibility Human observational (Morizane et al., multiple groups) Supports link between low LL-37 and infection Moderate-High
LL-37 disrupts bacterial membranes in vitro In vitro (multiple labs, various organisms) Dose-dependent bactericidal or bacteriostatic High (for in vitro conditions)
Antimicrobial activity is suppressed by physiological salt concentrations In vitro, mechanistic Substantial potency loss vs low-salt buffer High
Vitamin D3 upregulates CAMP gene expression in human monocytes and keratinocytes Human cell studies and small human trials (Liu et al., 2006, Nature Medicine) Increase in LL-37 mRNA and peptide levels Moderate-High
Exogenous LL-37 accelerates wound healing in human skin Mostly animal and in vitro; very limited human data Positive in animal models Low (for human clinical use)
LL-37 promotes angiogenesis via VEGF upregulation In vitro and animal Pro-angiogenic; potential pro-tumorigenic in some cancer cell models Moderate (in vitro)
LL-37 reduces biofilm formation by P. aeruginosa In vitro (Overhage et al., 2008, J Bacteriol) Sub-MIC concentrations reduce biofilm at 0.5 to 2 micromolar Moderate (in vitro only)
Oral LL-37 supplementation raises systemic levels No bioavailability data in humans; mechanism predicts negligible absorption Not supported Very Low

What Most LL-37 Pages Get Wrong

The salt problem is the most underreported limitation in LL-37 research. Nearly every promotional peptide page describes LL-37's antimicrobial MIC values without disclosing that those values were measured in low-ionic-strength buffers (often Mueller-Hinton at reduced salt or phosphate buffer) rather than physiological conditions. Multiple research groups have documented that adding NaCl to physiological concentrations (approximately 150 mM) substantially reduces LL-37's antibacterial potency against certain organisms, particularly for organisms like S. aureus that reside in sodium-rich environments such as wound fluid or respiratory mucus. Cystic fibrosis lung research identified salt-mediated inactivation of cathelicidins as a partial explanation for increased bacterial colonization in CF airways. Any protocol or marketing claim that quotes a low MIC without specifying the buffer ionic strength is presenting an optimistic number.

A second omission: the pro-tumorigenic potential. LL-37 is overexpressed in several cancers including breast, colon, and lung tumors, and in vitro work from multiple independent groups shows it promotes migration, invasion, and VEGF-driven angiogenesis in cancer cell lines. This does not prove that exogenous LL-37 causes cancer, but it means that broad claims of LL-37 as a simple "healing" or "immune support" peptide ignore a significant and active area of oncology concern.

Why Does LL-37 Degrade and How Do You Prevent It?

The Chemistry Behind the Rules

LL-37 contains a methionine residue (Met) and several lysines that are degradation-sensitive. Methionine oxidation to methionine sulfoxide occurs on exposure to dissolved oxygen, UV light, or trace metals, and produces a peptide with shifted hydrophobicity and reduced membrane activity. This is why lyophilized LL-37 should be reconstituted under argon or nitrogen atmosphere in serious applications, and why headspace oxygen in a storage vial matters.

The peptide's strongly cationic nature (net charge approximately +6) drives self-aggregation through electrostatic repulsion at low concentration and hydrophobic clustering at higher concentration. Aggregation is temperature-accelerated and is irreversible beyond a certain threshold. Surfactant-free formulations at neutral pH in pure water are prone to adsorption onto polypropylene tube walls, which can cause apparent concentration loss that researchers misattribute to degradation. Using low-binding tubes or adding 0.01% bovine serum albumin as a carrier is standard practice in many published protocols.

Reconstitution solvent matters: pure water (pH roughly 7) causes some batches to aggregate immediately because near-neutral pH reduces net charge and permits hydrophobic contacts. Many researchers dissolve LL-37 first in a small volume of 0.1% acetic acid, which protonates lysines fully and improves initial solubility, then dilute to working concentration in the relevant buffer.

Storage Summary

FormRecommended TemperaturePractical Shelf LifeKey Risk
Lyophilized, sealedMinus 20 C or colder, desiccatedMulti-year when dry and sealedMoisture ingress on repeated opening
Reconstituted in waterMinus 80 C in single-use aliquotsMonths if no freeze-thaw cyclingAggregation, oxidation
Reconstituted in acetic acid solutionMinus 20 C, single-use aliquotsWeeks to monthsAcidic pH incompatible with some assays; neutralize before use
Working solution in PBS or media4 C, use within hoursHours to 1 dayRapid aggregation, protease activity if serum present

Honest Head-to-Head: LL-37 vs Alternatives

Parameter LL-37 Conventional Antibiotic (e.g., ciprofloxacin) Defensin Peptides (e.g., HBD-2)
Resistance development risk Low (membrane-physical mechanism) High (enzyme/target mutation) Low, similar mechanism
Activity in physiological salt Substantially reduced Not affected by ionic strength Also salt-sensitive for some defensins
Serum stability Rapid degradation by proteases Variable; many are stable Also protease-labile
Human clinical evidence Very limited RCT data Extensive RCT evidence base Very limited RCT data
Immunomodulatory activity Yes, multiple receptor targets Minimal or specific to drug class Yes, but different receptor profile
Biofilm disruption (in vitro) Demonstrated at sub-MIC concentrations Variable by drug and organism Less studied
Oral bioavailability Negligible (protease degradation) Variable; ciprofloxacin ~70-85% Negligible
Cost per mg (research grade) High (solid-phase synthesis, 37 AA) Very low (generics available) High
Pro-tumorigenic concern Yes, in vitro evidence exists Not applicable in same way Less studied

Honest verdict: For antimicrobial research in controlled in vitro conditions, LL-37 is a uniquely valuable tool because it models the human innate immune response. As a substitute for conventional antibiotics in any practical application, it currently loses on stability, bioavailability, clinical evidence, and cost. The peptide's real research value lies in understanding host defense mechanisms, not in replacing existing drugs.

How to Buy LL-37 Peptide: Label Literacy and COA Checklist

When evaluating any supplier offering LL-37 for sale, request and verify the following before purchase.

Document or SpecificationMinimum Acceptable StandardWhy It Matters
HPLC chromatogram with purity readoutGreater than or equal to 98% purityLower purity introduces truncated fragments that confound assays
Mass spectrometry (MALDI or ESI-MS)Observed mass within 1 Da of theoretical 4,493 DaConfirms correct sequence and rules out scrambled synthesis
Endotoxin test (LAL or recombinant factor C)Less than 1 EU per mg for cell-based workEndotoxin mimics LL-37 inflammatory signaling; ruins cytokine data
Synthesis method disclosureSolid-phase peptide synthesis (SPPS) statedConfirms synthetic origin; rules out biological extraction contamination
Amino acid sequence confirmedLLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES stated on COASome suppliers sell truncated analogs at LL-37 price
Lot number and manufacture dateTraceable lot with dateAllows you to track degradation timeline from date of synthesis
Counterion specificationTFA (trifluoroacetate) or acetate salt disclosedTFA counterion at high concentration is cytotoxic; may need to be exchanged for cell work
TFA counterion trap: Solid-phase synthesis uses trifluoroacetic acid (TFA) in cleavage steps. Residual TFA forms a salt with LL-37's cationic residues. At high peptide concentrations in cell culture, TFA itself is cytotoxic. If your COA does not specify the counterion or if you are working above 20 micromolar in cells, request acetate-exchanged or HCl-exchanged peptide, or perform your own counterion exchange.

Research Dosing and Concentration Reference Table

ApplicationTypical Concentration RangeBuffer/VehicleKey Note
Antimicrobial MIC determination (low-salt)0.5 to 32 micromolar10 mM sodium phosphate pH 7.4Not predictive of in vivo activity
Biofilm disruption (sub-MIC)0.5 to 2 micromolarLow-salt bufferBased on Overhage et al. 2008
LPS neutralization assay1 to 10 micromolarPBS or cell culture mediaRatio of LL-37 to LPS is critical variable
Cell viability/toxicity boundaryCytotoxicity often appears above 20 micromolarSerum-free mediaStrongly cell-type dependent; verify for each cell line
Wound healing migration assay0.1 to 2 micromolarSerum-reduced mediaHigher concentrations can inhibit migration
FPR2 receptor activation0.1 to 1 micromolarHBSS or physiological bufferReceptor-mediated effects at lower concentrations than membrane lysis

The Vitamin D Connection: Endogenous LL-37 Regulation

The CAMP gene promoter contains a functional vitamin D response element (VDRE). Liu et al. (2006, Nature Medicine) demonstrated that 1,25-dihydroxyvitamin D3 induced CAMP transcription in human monocytes and that this induction was essential for the bactericidal response to Mycobacterium tuberculosis. Subsequent work showed that the induction is also operative in skin keratinocytes after wounding and in bronchial epithelial cells.

This is scientifically significant for two reasons. First, it helps explain population-level correlations between vitamin D deficiency and susceptibility to respiratory and skin infections, though this epidemiological link does not prove causation. Second, it means that for researchers studying LL-37 biology, the vitamin D status of cell culture models (if any 1,25-D3 or UV exposure is involved) is a variable that must be controlled.

This connection is not an argument that vitamin D supplementation in humans produces clinically meaningful increases in antimicrobial defense. The magnitude of CAMP upregulation, the tissue-specific translation efficiency, and the in vivo functional consequence of that upregulation are all variable and are not established at the level of an intervention recommendation.

LL-37 is not a controlled substance in the United States, European Union, United Kingdom, Canada, or Australia as of 2026. It is legally purchasable as a research compound in most jurisdictions. It has not received FDA approval, EMA approval, or equivalent regulatory clearance for any human therapeutic indication. It cannot be legally marketed for human use, and compounding pharmacies are subject to jurisdiction-specific rules about peptide compounding that vary substantially by country and have been the subject of enforcement activity in the US (notably FDA actions targeting certain 503A and 503B compounders of unapproved peptides beginning in 2023).

LL-37 appears on the World Anti-Doping Agency (WADA) prohibited list under Section 2 (Peptide Hormones, Growth Factors, Related Substances and Mimetics) and its related category of substances with similar biological effects. Athletes subject to WADA-compliant anti-doping rules should be aware of this regardless of the legal status of purchase in their country.

Frequently Asked Questions

What is LL-37 peptide and what is it used for in research? LL-37 is the only human cathelicidin antimicrobial peptide. It is a 37-amino-acid, amphipathic alpha-helical peptide derived from the C-terminus of hCAP18. Research applications include studying innate immunity, wound healing, biofilm disruption, and immune modulation. It is not FDA-approved for any clinical indication.
Where can I buy LL-37 peptide for research? LL-37 for sale is available from peptide research suppliers. Key quality indicators are HPLC purity above 98%, a mass spectrometry confirmation report, and endotoxin testing results. Always request a certificate of analysis before purchasing.
What purity level should LL-37 have for research use? Research-grade LL-37 should be at least 98% pure by HPLC. Lower-purity batches introduce truncated peptide fragments and oxidized methionine species that confound assay results and can trigger false cytotoxicity signals.
How should LL-37 be stored to prevent degradation? Lyophilized LL-37 is stable at minus 20 degrees Celsius or colder when kept dry and away from light. Once reconstituted in sterile water or acetic acid solution, divide into single-use aliquots immediately and avoid freeze-thaw cycles, which promote aggregation through hydrophobic self-association.
What does the human evidence on LL-37 actually show? Most human evidence is observational: deficient LL-37 expression is linked to increased susceptibility to skin and respiratory infections in conditions like morbus Darier and atopic dermatitis. Controlled human intervention trials are very limited; the bulk of mechanistic data comes from in vitro and animal studies.
Can LL-37 be taken orally? Oral bioavailability of unmodified LL-37 is effectively zero. Gastric proteases degrade the peptide rapidly before systemic absorption. All published research uses parenteral, topical, or inhaled delivery. Claims about oral LL-37 supplementation are not supported by bioavailability data.
How does LL-37 compare to conventional antibiotics? LL-37 disrupts bacterial membranes through a physical mechanism that is harder for bacteria to develop resistance to than enzyme-targeted antibiotics. However, it is inactivated by physiological salt concentrations and serum proteins, which conventional antibiotics are not. This is its core practical limitation in systemic use.
Is LL-37 legal to buy? In most jurisdictions LL-37 is legal to purchase as a research compound. It is not a controlled substance. However, it is not FDA-approved for human therapeutic use, and regulations vary by country. It is also on the WADA prohibited list as a peptide, meaning athletes subject to anti-doping rules cannot use it.
What endotoxin limit is acceptable in LL-37 purchased for cell-based assays? For cell-based in vitro work the generally accepted endotoxin threshold is below 1 EU per milligram of peptide. LL-37 is produced synthetically via solid-phase synthesis, but resin reagents and handling can introduce endotoxin contamination that mimics LL-37 immunostimulatory effects and ruins immunology assay data.
What concentration is LL-37 typically used at in research? Published in vitro studies most commonly use LL-37 in the range of 1 to 10 micromolar for antimicrobial and immune-modulatory assays. Cytotoxicity to mammalian cells is typically observed at concentrations above 20 micromolar in cell culture, though this varies by cell type and media composition.
What are the signs that a batch of LL-37 has degraded? Visible aggregation or cloudiness after reconstitution, a shift from colorless to yellow, or loss of antimicrobial activity in a known assay all suggest degradation. A repeat HPLC trace showing new peaks at shorter retention times indicates peptide cleavage or oxidation products.
Does vitamin D affect LL-37 levels? Yes. The CAMP gene encoding hCAP18/LL-37 contains a vitamin D response element. Multiple human studies have shown that vitamin D3 supplementation raises LL-37 expression in monocytes and epithelial cells, though the magnitude depends on baseline vitamin D status and tissue type.

Sources

  1. Zanetti M. Cathelicidins, multifunctional peptides of the innate immunity. J Leukoc Biol. 2004;75(1):39-48. PubMed PMID: 14525967.
  2. Wimley WC, Hristova K. Antimicrobial peptides: successes, challenges and unanswered questions. J Membr Biol. 2011;239(1-2):27-34.
  3. Liu PT, Stenger S, Li H, et al. Toll-like receptor triggering of a vitamin D-mediated human antimicrobial response. Science. 2006;311(5768):1770-1773. PubMed PMID: 16497887.
  4. Overhage J, Campisano A, Bains M, et al. Human host defense peptide LL-37 prevents bacterial biofilm formation. Infect Immun. 2008;76(9):4176-4182.
  5. Morizane S, Yamasaki K,
    LL-37

    Ready when you are

    LL-37

    The body's natural antimicrobial defense peptide · From $199/mo · compounded by a licensed 503A pharmacy, dispensed only after provider review.

    View LL-37 →
    Browse the full catalog →

Research Snapshot

Provider review

Entities covered

Page type
Provider review
FormBlends review
Last reviewed
2026-05-30
FormBlends review
FormBlends official source
Official source
Found official source
Official source
Sequence official source
Official source
Before you buy
Confirm current pricing, medication availability, pharmacy sourcing, and cancellation terms directly with the provider.
Check before ordering

Provider pricing, medication availability, pharmacy partners, insurance support, and cancellation rules can change quickly. This snapshot is designed to make verification easier, not to replace checking the official source before making a medical or purchase decision. Last page review: 2026-05-30.

Evidence standard

How this page was source-checked

Editorial policy

FormBlends does not claim an individual clinician byline unless a named reviewer is available. For this page, the editorial team checks medical and regulatory claims against primary sources, clinical trials, public datasets, and regulator guidance.

PubMed evidence trail

Research sources used to frame this page

For LL-37 Peptide Buy: Review, Evidence & Sourcing Guide | FormBlends, FormBlends checks the page topic against primary trials, systematic reviews, guidelines, and current PubMed-indexed literature where available. These citations are context, not medical advice, proof of eligibility, or a claim that every study applies to every patient.

Comparison decision path

Use this comparison to narrow the provider review question

Direct answer

LL-37 Peptide Buy: Review, Evidence & Sourcing Guide should help you decide which option deserves a clinical review, not force a one-size answer.

Evidence check

A strong comparison should connect mechanism, evidence strength, safety, access, and cost instead of only naming a winner.

Safety check

The right choice can change based on history, medication interactions, side effects, budget, and availability.

Next step

After comparing, use the get-started flow to route your goals and health history into the right prescription review path.

Original tools and data

Use the FormBlends research stack

These assets are built to be useful beyond a single article: shareable data pages, calculators, provider comparisons, and safety checks that give Google and readers something original to crawl.

Editorial refresh

Practical 2026 note for LL

For this peptide therapy page, the 2026 refresh focuses on cash-pay pricing, peptides, buy, review so the article stays close to the question behind "LL".

The useful details are the practical ones: what to verify, what changes risk or cost, and which details separate LL from nearby GLP-1, peptide, hormone, or provider-comparison searches.

Readers can use the added context to bring sharper questions to a licensed provider before making a treatment, cost, or care decision.

LL custom 2026 image for peptide therapy on FormBlends

Custom 2026 image for LL, peptide therapy, and better treatment decision-making.

Image description: Unique image for this page covering LL, peptide therapy, safety, cost, provider selection, and patient decision-making.

Download the Peptide Quick Reference Card

A printable 2-page reference covering popular peptides, dosing ranges, stacking protocols, and storage.

Free download. We'll also send helpful GLP-1 guides to your inbox. Unsubscribe anytime.

Medical Disclaimer: This content is for informational purposes only and does not constitute medical advice. Always consult a qualified healthcare provider before starting, stopping, or changing any medication or treatment. FormBlends articles are source-checked against medical and regulatory references, but they are not a substitute for a personal medical consultation.

Disclosure: FormBlends is one of the providers discussed in this article. Our editorial team independently researches and verifies all pricing and claims. Pricing was last verified in March 2026. Read our editorial policy.

Written by the FormBlends Medical Team, a group of biomedical scientists and clinical researchers.

Medical content team. This article was researched against primary regulatory, trial, prescribing, and manufacturer sources where available. Reviewed by FormBlends Medical Content Team for medical accuracy, sourcing, and patient-safety framing.

Ready to get started?

Provider-reviewed GLP-1 and peptide therapy, delivered to your door.

Start Your Consultation

Ready to Start Your Weight Loss Journey?

Get a free medical consultation with a licensed provider. Compounded GLP-1 medications starting at $99/month with free shipping.

Next Best Reads

Free Tools

Provider-informed calculators to support your weight loss journey.