Trust Signals
- Written by the FormBlends Medical Team, a group of biomedical scientists and clinical researchers.
- All evidence claims are graded by study type. Mechanism is separated from clinical proof throughout.
- No affiliate relationship with any specific supplier is disclosed on this page. All comparison data is independent.
- Last reviewed and updated: 2026-05-29.
- This page is for research and educational purposes. LL-37 is not FDA-approved for human therapeutic use.
Key Takeaways
- LL-37 is a 37-amino-acid cathelicidin peptide (residues 134 to 170 of hCAP18) and the only human cathelicidin; its CAMP gene contains a vitamin D response element that measurably regulates expression in monocytes and epithelial cells.
- The strongest human evidence links LL-37 deficiency to infection susceptibility (morbus Darier, atopic dermatitis); controlled human intervention trials evaluating exogenous LL-37 administration are very limited as of 2026.
- Physiological salt concentrations (roughly 150 mM NaCl) substantially reduce LL-37 antimicrobial potency in vitro, the single most important limitation most peptide vendor pages omit.
- Endotoxin contamination below 1 EU per milligram is the correct threshold for cell-based assays; batches without LAL or rFC endotoxin test results can produce entirely artifactual cytokine data.
- LL-37 is on the WADA prohibited list under the Peptides and Regulatory Hormones category, meaning competitive athletes face anti-doping consequences regardless of jurisdiction legality.
What Is LL-37 and Should You Buy It for Research?
Table of Contents
- What exactly is LL-37 peptide?
- How does LL-37 work at the molecular level?
- What does the evidence actually show? (Graded ledger)
- What most LL-37 pages get wrong
- Why does LL-37 degrade and how do you prevent it?
- Honest head-to-head: LL-37 vs alternatives
- How to buy LL-37 peptide: label literacy and COA checklist
- Research dosing and concentration reference table
- The vitamin D connection: endogenous regulation
- Legal and regulatory status in 2026
- Frequently Asked Questions
What Exactly Is LL-37 Peptide?
LL-37 is a cationic, amphipathic alpha-helical peptide of 37 amino acids (molecular weight approximately 4,493 Da). Its name reflects its two N-terminal leucines and its length. It is the C-terminal proteolytic fragment of hCAP18 (human cationic antimicrobial protein of 18 kDa), encoded by the CAMP gene on chromosome 3p21.3. It is the sole member of the cathelicidin family expressed in humans.
Check your GLP-1 eligibility
Use our free BMI Calculator to see if you may qualify for provider-reviewed GLP-1 therapy.
Try the BMI Calculator →The sequence is: LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES. Key structural features include a net charge of roughly +6 at physiological pH and a hydrophobic moment that permits membrane intercalation. In aqueous solution LL-37 is largely unstructured; it adopts its alpha-helical conformation on contact with anionic bacterial membranes or in the presence of lipopolysaccharide.
Natural sources of LL-37 in the body include neutrophil granules, skin keratinocytes (especially after injury), mucosal epithelial cells, and seminal plasma. Expression is upregulated by infection, wounding, and vitamin D receptor activation.
How Does LL-37 Work at the Molecular Level?
LL-37 operates through at least three distinct mechanisms that are important to distinguish because their evidence bases differ substantially.
Membrane Disruption (Antimicrobial Mechanism)
The best-characterized action is electrostatic attraction to anionic bacterial membranes (bacterial outer leaflets are enriched in phosphatidylglycerol and cardiolipin, in contrast to the zwitterionic outer leaflet of mammalian cells). Once bound, the peptide inserts its hydrophobic face into the bilayer. At concentrations above a critical threshold, it forms toroidal pores or induces carpet-model lysis. Published minimum inhibitory concentration values for LL-37 against Staphylococcus aureus, Escherichia coli, and Pseudomonas aeruginosa in low-salt buffers fall approximately in the 1 to 16 micromolar range across multiple in vitro studies. The caveat: in physiological saline (150 mM NaCl) or serum, antimicrobial activity drops markedly because salt shields the electrostatic interaction and serum proteins sequester the peptide.
LPS and Nucleic Acid Binding (Immunomodulatory Mechanism)
LL-37 binds lipopolysaccharide with high affinity, neutralizing its ability to activate TLR4 and suppressing downstream NF-kB signaling. Separately, LL-37 can form complexes with self-DNA or RNA released during cell death; these complexes are taken up by plasmacytoid dendritic cells via endocytosis and stimulate TLR7 and TLR9, driving type I interferon responses. This dual capacity to both suppress and amplify innate immune signaling is context-dependent and concentration-dependent, which is why in vitro immunology results with LL-37 vary substantially across labs and cell models.
Receptor-Mediated Signaling
LL-37 activates formyl peptide receptor-like 1 (FPRL1, now designated FPR2) on neutrophils, monocytes, and mast cells at nanomolar to low micromolar concentrations. It also transactivates EGFR on epithelial cells, a pathway implicated in wound healing responses. Upregulation of VEGF expression in several cell lines has been observed, raising a noted concern in oncology research: several groups have found that LL-37 promotes tumor cell migration and angiogenesis in breast and ovarian cancer models, a pro-tumorigenic effect that commodity peptide pages reliably omit.
What Does the Evidence Actually Show? (Graded Ledger)
| Claim | Best Evidence Type | Effect Direction | Confidence |
|---|---|---|---|
| LL-37 deficiency in morbus Darier patients increases bacterial skin infection susceptibility | Human observational (Morizane et al., multiple groups) | Supports link between low LL-37 and infection | Moderate-High |
| LL-37 disrupts bacterial membranes in vitro | In vitro (multiple labs, various organisms) | Dose-dependent bactericidal or bacteriostatic | High (for in vitro conditions) |
| Antimicrobial activity is suppressed by physiological salt concentrations | In vitro, mechanistic | Substantial potency loss vs low-salt buffer | High |
| Vitamin D3 upregulates CAMP gene expression in human monocytes and keratinocytes | Human cell studies and small human trials (Liu et al., 2006, Nature Medicine) | Increase in LL-37 mRNA and peptide levels | Moderate-High |
| Exogenous LL-37 accelerates wound healing in human skin | Mostly animal and in vitro; very limited human data | Positive in animal models | Low (for human clinical use) |
| LL-37 promotes angiogenesis via VEGF upregulation | In vitro and animal | Pro-angiogenic; potential pro-tumorigenic in some cancer cell models | Moderate (in vitro) |
| LL-37 reduces biofilm formation by P. aeruginosa | In vitro (Overhage et al., 2008, J Bacteriol) | Sub-MIC concentrations reduce biofilm at 0.5 to 2 micromolar | Moderate (in vitro only) |
| Oral LL-37 supplementation raises systemic levels | No bioavailability data in humans; mechanism predicts negligible absorption | Not supported | Very Low |
What Most LL-37 Pages Get Wrong
A second omission: the pro-tumorigenic potential. LL-37 is overexpressed in several cancers including breast, colon, and lung tumors, and in vitro work from multiple independent groups shows it promotes migration, invasion, and VEGF-driven angiogenesis in cancer cell lines. This does not prove that exogenous LL-37 causes cancer, but it means that broad claims of LL-37 as a simple "healing" or "immune support" peptide ignore a significant and active area of oncology concern.
Why Does LL-37 Degrade and How Do You Prevent It?
The Chemistry Behind the Rules
LL-37 contains a methionine residue (Met) and several lysines that are degradation-sensitive. Methionine oxidation to methionine sulfoxide occurs on exposure to dissolved oxygen, UV light, or trace metals, and produces a peptide with shifted hydrophobicity and reduced membrane activity. This is why lyophilized LL-37 should be reconstituted under argon or nitrogen atmosphere in serious applications, and why headspace oxygen in a storage vial matters.
The peptide's strongly cationic nature (net charge approximately +6) drives self-aggregation through electrostatic repulsion at low concentration and hydrophobic clustering at higher concentration. Aggregation is temperature-accelerated and is irreversible beyond a certain threshold. Surfactant-free formulations at neutral pH in pure water are prone to adsorption onto polypropylene tube walls, which can cause apparent concentration loss that researchers misattribute to degradation. Using low-binding tubes or adding 0.01% bovine serum albumin as a carrier is standard practice in many published protocols.
Reconstitution solvent matters: pure water (pH roughly 7) causes some batches to aggregate immediately because near-neutral pH reduces net charge and permits hydrophobic contacts. Many researchers dissolve LL-37 first in a small volume of 0.1% acetic acid, which protonates lysines fully and improves initial solubility, then dilute to working concentration in the relevant buffer.
Storage Summary
| Form | Recommended Temperature | Practical Shelf Life | Key Risk |
|---|---|---|---|
| Lyophilized, sealed | Minus 20 C or colder, desiccated | Multi-year when dry and sealed | Moisture ingress on repeated opening |
| Reconstituted in water | Minus 80 C in single-use aliquots | Months if no freeze-thaw cycling | Aggregation, oxidation |
| Reconstituted in acetic acid solution | Minus 20 C, single-use aliquots | Weeks to months | Acidic pH incompatible with some assays; neutralize before use |
| Working solution in PBS or media | 4 C, use within hours | Hours to 1 day | Rapid aggregation, protease activity if serum present |
Honest Head-to-Head: LL-37 vs Alternatives
| Parameter | LL-37 | Conventional Antibiotic (e.g., ciprofloxacin) | Defensin Peptides (e.g., HBD-2) |
|---|---|---|---|
| Resistance development risk | Low (membrane-physical mechanism) | High (enzyme/target mutation) | Low, similar mechanism |
| Activity in physiological salt | Substantially reduced | Not affected by ionic strength | Also salt-sensitive for some defensins |
| Serum stability | Rapid degradation by proteases | Variable; many are stable | Also protease-labile |
| Human clinical evidence | Very limited RCT data | Extensive RCT evidence base | Very limited RCT data |
| Immunomodulatory activity | Yes, multiple receptor targets | Minimal or specific to drug class | Yes, but different receptor profile |
| Biofilm disruption (in vitro) | Demonstrated at sub-MIC concentrations | Variable by drug and organism | Less studied |
| Oral bioavailability | Negligible (protease degradation) | Variable; ciprofloxacin ~70-85% | Negligible |
| Cost per mg (research grade) | High (solid-phase synthesis, 37 AA) | Very low (generics available) | High |
| Pro-tumorigenic concern | Yes, in vitro evidence exists | Not applicable in same way | Less studied |
Honest verdict: For antimicrobial research in controlled in vitro conditions, LL-37 is a uniquely valuable tool because it models the human innate immune response. As a substitute for conventional antibiotics in any practical application, it currently loses on stability, bioavailability, clinical evidence, and cost. The peptide's real research value lies in understanding host defense mechanisms, not in replacing existing drugs.
How to Buy LL-37 Peptide: Label Literacy and COA Checklist
When evaluating any supplier offering LL-37 for sale, request and verify the following before purchase.
| Document or Specification | Minimum Acceptable Standard | Why It Matters |
|---|---|---|
| HPLC chromatogram with purity readout | Greater than or equal to 98% purity | Lower purity introduces truncated fragments that confound assays |
| Mass spectrometry (MALDI or ESI-MS) | Observed mass within 1 Da of theoretical 4,493 Da | Confirms correct sequence and rules out scrambled synthesis |
| Endotoxin test (LAL or recombinant factor C) | Less than 1 EU per mg for cell-based work | Endotoxin mimics LL-37 inflammatory signaling; ruins cytokine data |
| Synthesis method disclosure | Solid-phase peptide synthesis (SPPS) stated | Confirms synthetic origin; rules out biological extraction contamination |
| Amino acid sequence confirmed | LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES stated on COA | Some suppliers sell truncated analogs at LL-37 price |
| Lot number and manufacture date | Traceable lot with date | Allows you to track degradation timeline from date of synthesis |
| Counterion specification | TFA (trifluoroacetate) or acetate salt disclosed | TFA counterion at high concentration is cytotoxic; may need to be exchanged for cell work |
Research Dosing and Concentration Reference Table
| Application | Typical Concentration Range | Buffer/Vehicle | Key Note |
|---|---|---|---|
| Antimicrobial MIC determination (low-salt) | 0.5 to 32 micromolar | 10 mM sodium phosphate pH 7.4 | Not predictive of in vivo activity |
| Biofilm disruption (sub-MIC) | 0.5 to 2 micromolar | Low-salt buffer | Based on Overhage et al. 2008 |
| LPS neutralization assay | 1 to 10 micromolar | PBS or cell culture media | Ratio of LL-37 to LPS is critical variable |
| Cell viability/toxicity boundary | Cytotoxicity often appears above 20 micromolar | Serum-free media | Strongly cell-type dependent; verify for each cell line |
| Wound healing migration assay | 0.1 to 2 micromolar | Serum-reduced media | Higher concentrations can inhibit migration |
| FPR2 receptor activation | 0.1 to 1 micromolar | HBSS or physiological buffer | Receptor-mediated effects at lower concentrations than membrane lysis |
The Vitamin D Connection: Endogenous LL-37 Regulation
The CAMP gene promoter contains a functional vitamin D response element (VDRE). Liu et al. (2006, Nature Medicine) demonstrated that 1,25-dihydroxyvitamin D3 induced CAMP transcription in human monocytes and that this induction was essential for the bactericidal response to Mycobacterium tuberculosis. Subsequent work showed that the induction is also operative in skin keratinocytes after wounding and in bronchial epithelial cells.
This is scientifically significant for two reasons. First, it helps explain population-level correlations between vitamin D deficiency and susceptibility to respiratory and skin infections, though this epidemiological link does not prove causation. Second, it means that for researchers studying LL-37 biology, the vitamin D status of cell culture models (if any 1,25-D3 or UV exposure is involved) is a variable that must be controlled.
This connection is not an argument that vitamin D supplementation in humans produces clinically meaningful increases in antimicrobial defense. The magnitude of CAMP upregulation, the tissue-specific translation efficiency, and the in vivo functional consequence of that upregulation are all variable and are not established at the level of an intervention recommendation.
Legal and Regulatory Status in 2026
LL-37 is not a controlled substance in the United States, European Union, United Kingdom, Canada, or Australia as of 2026. It is legally purchasable as a research compound in most jurisdictions. It has not received FDA approval, EMA approval, or equivalent regulatory clearance for any human therapeutic indication. It cannot be legally marketed for human use, and compounding pharmacies are subject to jurisdiction-specific rules about peptide compounding that vary substantially by country and have been the subject of enforcement activity in the US (notably FDA actions targeting certain 503A and 503B compounders of unapproved peptides beginning in 2023).
LL-37 appears on the World Anti-Doping Agency (WADA) prohibited list under Section 2 (Peptide Hormones, Growth Factors, Related Substances and Mimetics) and its related category of substances with similar biological effects. Athletes subject to WADA-compliant anti-doping rules should be aware of this regardless of the legal status of purchase in their country.
Frequently Asked Questions
Sources
- Zanetti M. Cathelicidins, multifunctional peptides of the innate immunity. J Leukoc Biol. 2004;75(1):39-48. PubMed PMID: 14525967.
- Wimley WC, Hristova K. Antimicrobial peptides: successes, challenges and unanswered questions. J Membr Biol. 2011;239(1-2):27-34.
- Liu PT, Stenger S, Li H, et al. Toll-like receptor triggering of a vitamin D-mediated human antimicrobial response. Science. 2006;311(5768):1770-1773. PubMed PMID: 16497887.
- Overhage J, Campisano A, Bains M, et al. Human host defense peptide LL-37 prevents bacterial biofilm formation. Infect Immun. 2008;76(9):4176-4182.
- Morizane S, Yamasaki K,
Related peptide guides